PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.B91MN
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 303aa    MW: 34376.1 Da    PI: 7.8219
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.B91MNgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.9e-331972255
      G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 prlrWtpeLH++Fv+a+++LGG++kAtPk +l+lm+vkgLt++hvkSHLQ+YR+
  Araip.B91MN 19 PRLRWTPELHRCFVHAIDSLGGHHKATPKLVLQLMDVKGLTISHVKSHLQMYRS 72
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-311574IPR009057Homeodomain-like
PROSITE profilePS5129410.9711575IPR017930Myb domain
SuperFamilySSF466891.79E-151772IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-231972IPR006447Myb domain, plants
PfamPF002491.0E-72071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MATCGREGAV RQYIRSKVPR LRWTPELHRC FVHAIDSLGG HHKATPKLVL QLMDVKGLTI  60
SHVKSHLQMY RSMRGDLGRQ GRISSSQHRN QSFEEHDDGC VEEVNDVNNN NNNHNQNYHP  120
CSQSIGKESD SLFGYSNFSP KRARIERNYS ISQNLQCRNQ RTVPYPYSFY DYAYSTQQQQ  180
HQPPHSTVFP MLPPLLGNFL QVTKLNDRET TSEAMTNNNN NNNVLLNINK NNNTEKKARA  240
EEDEDEDVGR ECELSLSLTL PNPSPQRSSN VSSASEITEA AISSSCSTTL KHRINLDLSL  300
SLC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0982251e-109BT098225.1 Soybean clone JCVI-FLGm-16F9 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177422.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A151TQ571e-114A0A151TQ57_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGGLYMA20G24290.11e-112(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF55393353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.11e-34G2-like family protein